Your Ad Here
How to make humans

Compilation of free information about human parts, their function, assembly,  repair, and maintenance

Corticotropin-releasing hormone

Corticotropin-releasing hormone
Identifiers
Symbol CRH
Entrez 1392
HUGO 2355
OMIM 122560
RefSeq NM_000756
UniProt P06850
Other data
Locus Chr. 8 q13

Corticotropin-releasing hormone (CRH), originally named corticotropin-releasing factor (CRF), and also called corticoliberin, is a polypeptide hormone and neurotransmitter involved in the stress response.

Hormonal actions

CRH is produced by neuroendocrine cells in the paraventricular nucleus of the hypothalamus and is released from neurosecretory terminals of these neurons into the primary capillary plexus of the hypothalamo-hypophyseal portal system. The portal system carries the CRH to the anterior lobe of the pituitary, where it stimulates corticotropes to secrete corticotropin (ACTH) and other biologically active substances (for example β-endorphin).

ά-helical CRH-(9--41) acts as a CRH antagonist[1].

Psychopharmacy

The CRH-1 receptor antagonist pexacerfont is currently under investigation for the treatment of Generalized Anxiety Disorder in women[2].

Role in parturition

CRH is also synthesized by the placenta and seems to determine the duration of pregnancy[3].

Structure

The 41-amino acid sequence of CRH was first discovered in sheep by Vale et al in 1981[4]. Its full sequence is

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

See also

References

  1. ^ Santos, Javier, Paul R. Saunders, Nico P. M. Hanssen, Ping-Chang Yang, Derrick Yates, Jack A. Groot, and Mary H. Perdue. Corticotropin-releasing hormone mimics stress-induced colonic epithelial pathophysiology in the rat. Am. J. Physiol. 277 (Gastrointest. Liver Physiol. 40): G391-G399, 1999
  2. ^ http://www.clinicaltrials.gov/ct/show/NCT00481325?order=31
  3. ^ http://users.rcn.com/jkimball.ma.ultranet/BiologyPages/H/
  4. Hypothalamus.html#CRH
  5. ^ Vale,W., Spiess,J., Rivier,C. and Rivier,J. Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin Science 213 (4514), 1394-1397 (1981)

The content of this section is licensed under the GNU Free Documentation License (local copy). It uses material from the Wikipedia article "Corticotropin-releasing hormone" modified March 15, 2007 with previous authors listed in its history.

Your Ad Here
Share on Facebook Delicious Bookmark this on Delicious